PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.002G232200.1
Common NamePHAVU_002G232200g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family HB-other
Protein Properties Length: 1791aa    MW: 200854 Da    PI: 5.2288
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.002G232200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.31.3e-1849104257
                         T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
            Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                          kR+  t+ qle+Le++++ ++yps+++r eL++klgL++rq ++WF+ rR k+kk
  Phvul.002G232200.1  49 PKRQMKTPFQLETLEKAYAVDNYPSETMRGELSEKLGLSDRQLQMWFCHRRLKDKK 104
                         69****************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.8E-1928104IPR009057Homeodomain-like
SuperFamilySSF466896.84E-1733104IPR009057Homeodomain-like
PROSITE profilePS5007116.64945105IPR001356Homeobox domain
SMARTSM003895.6E-1847109IPR001356Homeobox domain
PfamPF000463.1E-1649104IPR001356Homeobox domain
CDDcd000863.64E-1450104No hitNo description
PROSITE profilePS5082716.1559618IPR018501DDT domain
SMARTSM005714.5E-20559618IPR018501DDT domain
PfamPF027913.3E-16561615IPR018501DDT domain
PfamPF050662.7E-16741809IPR007759HB1/Asxl, restriction endonuclease HTH domain
PfamPF156126.3E-9947989IPR028942WHIM1 domain
PfamPF156133.5E-1111231195IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1791 aa     Download sequence    Send to blast
MEEEGYSEGD NNRKRGGTDD DSNENNNNNN TNHGSSSKIV NSNEGQSKPK RQMKTPFQLE  60
TLEKAYAVDN YPSETMRGEL SEKLGLSDRQ LQMWFCHRRL KDKKDLTSKK LPRKVVVEPL  120
PESPTDDPML GPQELGNEYG SGSGSGSSPY ARVEPLNIVP RGVPGYYESP RAMMENRAIS  180
CVEAQLGEPL REDGPILGVE FDPLPPDAFG APIAVTEQQK LPTFAYESKI YERHDVRANK  240
AMTRTFRDYR SLPSQSGTRS DTSGPFSKSH LHDPIEGPAR NPHLALGNET IPRIRAGQGQ  300
FRGRLLSQQD KQLIPNQSPT RDDNAAPIRE VDPTILNVGT SSHFTDHQIV VPENLHSQPS  360
GQVLHNNNAT RIEKKRKSDD VRDGEAHEMK IRKEIEKQDN LRRKNEERMR KEIEKQDRER  420
KKEEERLMRE RQREEERARR EQKRELERRE KFLLKENLRV EKMKIREELR REKEAERRKA  480
ALEKATARRI AKESMELIED EQLEMMELAA SSKGFSSIIH LDFDTLQHVE SFRDSLCVFP  540
PKSVKLKKPF AIKPWMNSEK NVGNLLMVWR FLITFADVLE LWSFTLDEFV QAFHDYDSRL  600
LGEIHVALLK VVIKDIEDVA RTPSTGLGMN QNGAANSGGG HPEIVEGAYA WGFDIRNWHK  660
HLNLLTWPEI FRQLALSAGY GPQLKKRSTT CSYANNKDEG RSCEDIISKL RNGSAAENAV  720
TKMHERGLLA PRRSRHRLTP GTVKFAAFHV LSLEGDKGLT VLELAEKIQK SGLRDLTTSK  780
TPEASISVAL TRDTKLFERI APSTYCVRQA FRKNPADAES ILSDARKKIQ IFENGFLAEE  840
DTDDVEREES ESDEVDEDPE VDDLVNSSSA NKTSGPCDDF SSNGKENLGH DVGLQGEFDK  900
DLPRFPESGS KKIDTPIAVT GKPGACEDLN VGNLGEDNME IDESKPGESW VQGLAEGEFS  960
DLSVEERLNA LVVLVGVANE GNSIRVVLED RLEAANALKK QMWAEAQLDK FRLKDDIFSK  1020
SDFPSINGNK VEIQHSCSAM EGNQSPSLLG NNCNNVPSPG TAENQKAAPG VQSMSIEKHS  1080
SVQDLCTGPD NPQIQTFAQY SKRSRSQLKS YIFHIAEEMC AYRSLTLGQD RRRNRYWQFV  1140
ASASSNDPGS GRIFVEFLDG NWRLIDTEEA FDALLISLDS RGVRESHLRL MLQKVESSFK  1200
ENVRKNTQCS RVGSRGETCV KNEADETDSS PDRHTGSDSP SSTLCGLNSD SLETSSSFKI  1260
ELGKSESDKK SALRRYQDFQ KWTWKECYNS SILCAMKYGK KRGKSQVVVC DICLNPYFFE  1320
DSHCNCCHRT FPSNNGFNFS KHAFQCGEKL SKDICVLDSN LPLRTRLLKA LLAHIEVSIP  1380
PEAFQSNWIE DIRRHWSVKL SKSSSVEELL QILALLERAL KRDFLSSTFS TTGEQLGLNT  1440
MSENVAQTSA DSESVAVLPW VPLTTSAVSL RLFEFDESIV YLLHEKPEPS EEKEDRQYIK  1500
LPSRYNASKS IKVVETADLD CDEFMKVKSN PAKVVQNNNK RGRGSSVKGR VKNISKTKRN  1560
NGRRRSAKVA GNLNQRVKQQ GGGSQGQASG RGRRTIRKRR VGKKAVEDLL LGHRGASHSS  1620
NIAKESLRSL DEEWDDEKGS PMTPIHMGTA NISNSTEEAE SDDNVQAMES DDNVQAVESD  1680
DNGQAVESDD NGQAVESDDN GQAVEYDKGN WEIGFNGNPS RWREDMVGMS DEDVEASEDE  1740
NQNENGIEEN EEEDSDADAD VMSEEGSDGT ANRIVNEESS DSDVSEDSSD *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
197104RRLKDKKD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007159367.10.0hypothetical protein PHAVU_002G232200g
TrEMBLV7CR020.0V7CR02_PHAVU; Uncharacterized protein
STRINGGLYMA13G24370.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF25233369
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28420.10.0homeobox-1